PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G014200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 319aa    MW: 35699.8 Da    PI: 5.0453
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G014200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.2e-142168148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
  Aqcoe2G014200.1.p 21 KGLWSPEEDDKLMNYMLSNGQGCWSDVARNAGLQRCGKSCRLRWINYL 68
                       678*******************************************97 PP

2Myb_DNA-binding51.13.2e-1674117146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg+++++E+el+++++  lG++ W+ Ia++++ gRt++++k++w++
  Aqcoe2G014200.1.p  74 RGAFSPQEEELIIHLHSVLGNR-WSQIAARLP-GRTDNEIKNFWNS 117
                        89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-221371IPR009057Homeodomain-like
PROSITE profilePS5129416.2231668IPR017930Myb domain
SuperFamilySSF466896.64E-2819115IPR009057Homeodomain-like
SMARTSM007176.5E-102070IPR001005SANT/Myb domain
PfamPF002494.1E-132168IPR001005SANT/Myb domain
CDDcd001673.38E-82468No hitNo description
PROSITE profilePS5129425.58169123IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-2672124IPR009057Homeodomain-like
SMARTSM007171.5E-1573121IPR001005SANT/Myb domain
PfamPF002496.9E-1574117IPR001005SANT/Myb domain
CDDcd001677.64E-1176116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MRKPDPPGKN NMNTNNVKLR KGLWSPEEDD KLMNYMLSNG QGCWSDVARN AGLQRCGKSC  60
RLRWINYLRP DLKRGAFSPQ EEELIIHLHS VLGNRWSQIA ARLPGRTDNE IKNFWNSTIK  120
KRLKNSSTST SPNKSNASDP RDFTGGLFSM SEQDIMNLCM DSSSSSSSSM HAMVMRNRFD  180
PLPMLENSYD HMPNAGAGLF NVSACMTQVG IGDGFYGNHG IIGGGNIGLD QSELFIPSLE  240
SISIEENNIT DNTFEKTNNN NLLNNINIIN NNNNNNNIDN IVESGNYWGG ENLRMGEWNM  300
EELLEDVSSF PFLDFQVQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27191235108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010278997.11e-137PREDICTED: transcription factor MYB46-like
TrEMBLA0A0E4B8Y51e-131A0A0E4B8Y5_9R
STRINGVIT_06s0004g02110.t011e-129(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.18e-69myb domain protein 46